PDB entry 1hl6

View 1hl6 on RCSB PDB site
Description: a novel mode of rbd-protein recognition in the y14-mago complex
Deposited on 2003-03-13, released 2003-05-08
The last revision prior to the SCOP 1.67 freeze date was dated 2003-07-01, with a file datestamp of 2003-07-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1hl6a_
  • Chain 'B':
    Domains in SCOP 1.67: d1hl6b_
  • Chain 'C':
    Domains in SCOP 1.67: d1hl6c_
  • Chain 'D':
    Domains in SCOP 1.67: d1hl6d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hl6A (A:)
    madvldidnaeefevdedgdqgivrlkekakhrkgrgfgsdsntreaihsyervrneddd
    elepgpqrsvegwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalve
    yethkqalaakealngaeimgqtiqvdwcfvkgpkrvkksekrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hl6A (A:)
    aeefevdedgdqgivrlkekakhrkgrgfgpgpqrsvegwilfvtsiheeaqedeiqekf
    cdygeiknihlnldrrtgfskgyalveyethkqalaakealngaeimgqtiqvdwcfvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hl6B (B:)
    mstedfylryyvghkgkfgheflefefrpdgklryannsnykndtmirkeafvhqsvmee
    lkriiidseimqeddlpwpppdrvgrqeleivigdehisfttsktgslvdvnrskdpegl
    rcfyylvqdlkclvfsliglhfkikpipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hl6B (B:)
    edfylryyvghkgkfgheflefefrpdgklryannsntmirkeafvhqsvmeelkriiid
    seimqeddlpwpppdrvgrqeleivigdehisfttsktlvdvnrskdpeglrcfyylvqd
    lkclvfsliglhfkikp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hl6C (C:)
    madvldidnaeefevdedgdqgivrlkekakhrkgrgfgsdsntreaihsyervrneddd
    elepgpqrsvegwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalve
    yethkqalaakealngaeimgqtiqvdwcfvkgpkrvkksekrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hl6C (C:)
    efevdedgdqgivrlkekakhrkgrgfpgpqrsvegwilfvtsiheeaqedeiqekfcdy
    geiknihlnlfskgyalveyethkqalaakealngaeimgqtiqvdwcfvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hl6D (D:)
    mstedfylryyvghkgkfgheflefefrpdgklryannsnykndtmirkeafvhqsvmee
    lkriiidseimqeddlpwpppdrvgrqeleivigdehisfttsktgslvdvnrskdpegl
    rcfyylvqdlkclvfsliglhfkikpipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hl6D (D:)
    dfylryyvghkfgheflefefrpdgklryannsnykndtmirkeafvhqsvmeelkriii
    dseimqeddlpwpppdrvgrqeleivigdehisfttsktgslvdvnrskdpeglrcfyyl
    vqdlkclvfsliglhfkikpipr