PDB entry 1hl1

View 1hl1 on RCSB PDB site
Description: crystal structure of bacillus subtilis cota after20h soaking with abts
Class: oxidase (copper-dependent)
Keywords: oxidase (copper-dependent), laccase, endospore coat, reaction cycle, sporulation, oxidase, copper-binding
Deposited on 2003-03-12, released 2004-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-01-20, with a file datestamp of 2009-01-16.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: 0.3
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spore coat protein a
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hl1a4, d1hl1a5, d1hl1a6
  • Heterogens: CU1, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hl1A (A:)
    mtlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgpti
    evkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgype
    awfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkek
    rlklpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvw
    pyleveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaery
    diiidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkylasyps
    vqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptrgthp
    ihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlriaat
    fgpysgryvwhchilehedydmmrpmditdphk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hl1A (A:)
    tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
    vkrnenvyvkwmnnlpsthflpidhtihepevktvvhlhggvtpddsdgypeawfskdfe
    qtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrlklpsde
    ydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpylevepr
    kyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydiiidfta
    yegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkylasypsvqheriqn
    irtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptrgthpihlhlvsf
    rvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlriaatfgpysgry
    vwhchilehedydmmrpmditd