PDB entry 1hky

View 1hky on RCSB PDB site
Description: solution structure of a pan module from eimeria tenella
Class: adhesin
Keywords: nmr, pan module, eimeria tenella
Deposited on 2002-10-03, released 2002-10-17
The last revision prior to the SCOP 1.75 freeze date was dated 2002-10-17, with a file datestamp of 2007-07-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: microneme protein 5 precursor
  Species: Eimeria tenella
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9U966 (0-10)
  • Uniprot Q9U966 (11-85)
  Domains in SCOP 1.75: d1hkya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hkyA (A:)
  dykddddkvkltcyqngvsftggkaiseakaassqacqelcekdakcrfftlasgkcslf
  addaalrptksdgavsgnkrcilled