PDB entry 1hkw

View 1hkw on RCSB PDB site
Description: MYCOBACTERIUM DIAMINOPIMELATE DICARBOXYLASE (LysA)
Class: lyase
Keywords: lyase, decarboxylase, diaminopimelate, dapdc, plp, lysine pathway, mycobacterium tuberculosis, lysine synthetic pathway, psi, protein structure initiative, tb structural genomics consortium, tb, tbsgc
Deposited on 2003-03-11, released 2003-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diaminopimelate decarboxylase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 1HKW
    • Uniprot P31848 (1-446)
    Domains in SCOPe 2.07: d1hkwa1, d1hkwa2
  • Chain 'B':
    Compound: diaminopimelate decarboxylase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hkwb1, d1hkwb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hkwA (A:)
    mnellhlapnvwprnttrdevgvvciagipltqlaqeygtplfvideddfrsrcretaaa
    fgsganvhyaakaflcsevarwiseeglcldvctggelavalhasfpperitlhgnnksv
    seltaavkagvghivvdsmteierldaiageagivqdvlvrltvgveahthefistahed
    qkfglsvasgaamaavrrvfatdhlrlvglhshigsqifdvdgfelaahrvigllrdvvg
    efgpektaqiatvdlggglgisylpsddpppiaelaaklgtivsdestavglptpklvve
    pgraiagpgtitlyevgtvkdvdvsatahrryvsvdggmsdnirtalygaqydvrlvsrv
    sdappvparlvgkhcesgdiivrdtwvpddirpgdlvavaatgaycyslssrynmvgrpa
    vvavhagnarlvlrretvddllslevrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hkwA (A:)
    nellhlapnvwprnttrdevgvvciagipltqlaqeygtplfvideddfrsrcretaaaf
    gsganvhyaakaflcsevarwiseeglcldvctggelavalhasfpperitlhgnnksvs
    eltaavkagvghivvdsmteierldaiageagivqdvlvrltvgveahthefistahedq
    kfglsvasgaamaavrrvfatdhlrlvglhshigsqifdvdgfelaahrvigllrdvvge
    fgpektaqiatvdlggglgisylpsddpppiaelaaklgtivsdestavglptpklvvep
    graiagpgtitlyevgtvkdvdvsatahrryvsvdggmsdnirtalygaqydvrlvsrvs
    dappvparlvgkhcesgdiivrdtwvpddirpgdlvavaatgaycyslssrynmvgrpav
    vavhagnarlvlrretvddllslevr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hkwB (B:)
    mnellhlapnvwprnttrdevgvvciagipltqlaqeygtplfvideddfrsrcretaaa
    fgsganvhyaakaflcsevarwiseeglcldvctggelavalhasfpperitlhgnnksv
    seltaavkagvghivvdsmteierldaiageagivqdvlvrltvgveahthefistahed
    qkfglsvasgaamaavrrvfatdhlrlvglhshigsqifdvdgfelaahrvigllrdvvg
    efgpektaqiatvdlggglgisylpsddpppiaelaaklgtivsdestavglptpklvve
    pgraiagpgtitlyevgtvkdvdvsatahrryvsvdggmsdnirtalygaqydvrlvsrv
    sdappvparlvgkhcesgdiivrdtwvpddirpgdlvavaatgaycyslssrynmvgrpa
    vvavhagnarlvlrretvddllslevrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hkwB (B:)
    ellhlapnvwprnttrdevgvvciagipltqlaqeygtplfvideddfrsrcretaaafg
    sganvhyaakaflcsevarwiseeglcldvctggelavalhasfpperitlhgnnksvse
    ltaavkagvghivvdsmteierldaiageagivqdvlvrltvgveahthefistahedqk
    fglsvasgaamaavrrvfatdhlrlvglhshigsqifdvdgfelaahrvigllrdvvgef
    gpektaqiatvdlggglgisylpsddpppiaelaaklgtivsdestavglptpklvvepg
    raiagpgtitlyevgtvkdvdvsatahrryvsvdggmsdnirtalygaqydvrlvsrvsd
    appvparlvgkhcesgdiivrdtwvpddirpgdlvavaatgaycyslssrynmvgrpavv
    avhagnarlvlrretvddllslev