PDB entry 1hkt

View 1hkt on RCSB PDB site
Description: solution structure of the DNA-binding domain of drosophila heat shock transcription factor
Class: transcription regulation
Keywords: transcription regulation
Deposited on 1994-07-18, released 1994-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat-shock transcription factor
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hkta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hktA (A:)
gsgvpaflaklwrlvddadtnrlicwtkdgqsfviqnqaqfakellplnykhnnmasfir
qlnmygfhkitsidngglrfdrdeiefshpffkrnspflldqikrk