PDB entry 1hko

View 1hko on RCSB PDB site
Description: NMR structure of bovine cytochrome b5
Class: electron transport
Keywords: cytochrome, electron transfer protein, heme, electron transport
Deposited on 2003-03-10, released 2003-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome b5
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00171 (0-103)
  Domains in SCOPe 2.07: d1hkoa_
• Heterogens: HEM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hkoA (A:)
  aeesskavkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdate
  nfedvghstdarelsktfiigelhpddrskitkpsesiittids