PDB entry 1hkn

View 1hkn on RCSB PDB site
Description: a complex between acidic fibroblast growth factor and 5-amino-2-naphthalenesulfonate
Class: growth factor
Keywords: growth factor, mitogen, angiogenesis, heparin-binding
Deposited on 2003-03-10, released 2004-03-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.228
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1hkna_
  • Chain 'B':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1hknb_
  • Chain 'C':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1hknc_
  • Chain 'D':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1hknd_
  • Chain 'E':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1hkne_
  • Chain 'F':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1hknf_
  • Heterogens: N2M, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hknA (A:)
    nlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstet
    gqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgp
    rthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hknA (A:)
    kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
    dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
    ilflplpvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hknB (B:)
    nlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstet
    gqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgp
    rthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hknB (B:)
    kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
    dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
    ilflplpvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hknC (C:)
    nlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstet
    gqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgp
    rthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hknC (C:)
    kkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamd
    tdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqk
    ailflplpvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hknD (D:)
    nlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstet
    gqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgp
    rthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hknD (D:)
    kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
    dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
    ilflplpvss
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1hknE (E:)
    nlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstet
    gqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgp
    rthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hknE (E:)
    kkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamd
    tdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqk
    ailflplpvss
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1hknF (F:)
    nlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstet
    gqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgp
    rthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hknF (F:)
    kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
    dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
    ilflplpvs