PDB entry 1hkm

View 1hkm on RCSB PDB site
Description: high resolution crystal structure of human chitinase in complex with demethylallosamidin
Deposited on 2003-03-10, released 2004-03-11
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-11, with a file datestamp of 2004-03-11.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.213
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hkmA (A:)
    aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
    glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
    pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
    qnldfvnlmaydfhgswekvtghnsplykrqeqsgaaaslnvdaavqqwlqkgtpaskli
    lgmptygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqk
    vpyifrdnqwvgfddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtl
    rqels