PDB entry 1hkd

View 1hkd on RCSB PDB site
Description: structure of pea lectin in complex with alpha-methyl-d-glucopyranoside
Class: plant lectin
Keywords: plant lectin, carbohydrate binding protein,calcium, glycoprotein
Deposited on 2003-03-06, released 2003-03-18
The last revision prior to the SCOP 1.73 freeze date was dated 2003-03-18, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.16526
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pea lectin alpha chain
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1hkd.1
  • Chain 'B':
    Compound: pea lectin beta chain
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1hkd.1
  • Chain 'C':
    Compound: pea lectin alpha chain
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1hkd.2
  • Chain 'D':
    Compound: pea lectin beta chain
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1hkd.2
  • Heterogens: GYP, CA, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hkdA (A:)
    tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
    anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
    dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
    n
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hkdB (B:)
    vtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsgtsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hkdB (B:)
    vtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsgt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hkdC (C:)
    tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
    anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
    dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
    n
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hkdD (D:)
    vtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsgtsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hkdD (D:)
    vtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsgt