PDB entry 1hkd

View 1hkd on RCSB PDB site
Description: Structure of pea lectin in complex with alpha-methyl-D-glucopyranoside
Class: plant lectin
Keywords: plant lectin, carbohydrate binding protein, calcium, glycoprotein
Deposited on 2003-03-06, released 2003-03-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pea lectin alpha chain
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hkd.1
  • Chain 'B':
    Compound: pea lectin beta chain
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hkd.1
  • Chain 'C':
    Compound: pea lectin alpha chain
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hkd.2
  • Chain 'D':
    Compound: pea lectin beta chain
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hkd.2
  • Heterogens: CA, MN, GYP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hkdA (A:)
    tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
    anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
    dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
    n
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hkdB (B:)
    vtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsgtsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hkdB (B:)
    vtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsgt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hkdC (C:)
    tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
    anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
    dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
    n
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hkdD (D:)
    vtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsgtsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hkdD (D:)
    vtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsgt