PDB entry 1hk9

View 1hk9 on RCSB PDB site
Description: crystal structure of the hfq protein from escherichia coli
Class: RNA-binding protein
Keywords: RNA-binding protein, sm-like, pleiotropic regulator, RNA binding protein, RNA chaperone
Deposited on 2003-03-06, released 2003-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.208
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein hfq
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hk9a_
  • Chain 'B':
    Compound: Protein hfq
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hk9b_
  • Chain 'C':
    Compound: Protein hfq
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hk9c_
  • Chain 'D':
    Compound: Protein hfq
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hk9d_
  • Chain 'E':
    Compound: Protein hfq
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hk9e_
  • Chain 'F':
    Compound: Protein hfq
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hk9f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hk9A (A:)
    gamakgqslqdpflnalrrervpvsiylvngiklqgqiesfdqfvillkntvsqmvykha
    istvvpsrpvshhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hk9A (A:)
    slqdpflnalrrervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvps
    rpvsh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hk9B (B:)
    gamakgqslqdpflnalrrervpvsiylvngiklqgqiesfdqfvillkntvsqmvykha
    istvvpsrpvshhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hk9B (B:)
    slqdpflnalrrervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvps
    rpvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hk9C (C:)
    gamakgqslqdpflnalrrervpvsiylvngiklqgqiesfdqfvillkntvsqmvykha
    istvvpsrpvshhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hk9C (C:)
    slqdpflnalrrervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvps
    rpvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hk9D (D:)
    gamakgqslqdpflnalrrervpvsiylvngiklqgqiesfdqfvillkntvsqmvykha
    istvvpsrpvshhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hk9D (D:)
    gqslqdpflnalrrervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvv
    psrpvsh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1hk9E (E:)
    gamakgqslqdpflnalrrervpvsiylvngiklqgqiesfdqfvillkntvsqmvykha
    istvvpsrpvshhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hk9E (E:)
    gqslqdpflnalrrervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvv
    psrpvshh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1hk9F (F:)
    gamakgqslqdpflnalrrervpvsiylvngiklqgqiesfdqfvillkntvsqmvykha
    istvvpsrpvshhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hk9F (F:)
    lqdpflnalrrervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvpsr
    pvshhs