PDB entry 1hk7

View 1hk7 on RCSB PDB site
Description: Middle Domain of HSP90
Class: chaperone
Keywords: heat shock protein, ATPase, chaperone
Deposited on 2003-03-06, released 2004-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat shock protein hsp82
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hk7a_
  • Chain 'B':
    Compound: heat shock protein hsp82
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hk7b_
  • Heterogens: CD, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hk7A (A:)
    tkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfdlf
    eskkkknniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnlsremlqqnkimkvi
    rknivkklieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstksvd
    eltsltdyvtrmpehqkniyyitgeslkavekspfldalkaknfevlfltdpideyaftq
    lkefegktlvditkdfeleetdeekaerekeikeyepltkalkeilgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hk7A (A:)
    tkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfdlf
    eskkkknniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnqnkimkvirknivkk
    lieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstksvdeltsltd
    yvtrmpehqkniyyitgeslkavekspfldalkaknfevlfltdpideyaftqlkefegk
    tlvditkdf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hk7B (B:)
    tkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfdlf
    eskkkknniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnlsremlqqnkimkvi
    rknivkklieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstksvd
    eltsltdyvtrmpehqkniyyitgeslkavekspfldalkaknfevlfltdpideyaftq
    lkefegktlvditkdfeleetdeekaerekeikeyepltkalkeilgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hk7B (B:)
    tkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfdli
    klyvrrvfitdeaedlipewlsfvkgvvdsedlplnlsremlqqnkimkvirknivkkli
    eafneiaedseqfekfysafskniklgvhedtqnraalakllrynstksvdeltsltdyv
    trmpehqkniyyitgeslkavekspfldalkaknfevlfltdpideyaftqlkefegktl
    vditkdf