PDB entry 1hk6

View 1hk6 on RCSB PDB site
Description: Ral binding domain from Sec5
Class: exocytosis
Keywords: ipt ral sec5 exocyst, exocytosis, protein transport, immunoglobulin fold
Deposited on 2003-03-05, released 2003-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exocyst complex component sec5
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1HK6 (0-1)
    • Uniprot Q9D4H1 (2-94)
    Domains in SCOPe 2.08: d1hk6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hk6A (A:)
    hmrqpplvtgispnegipwtkvtirgenlgtgptdliglticghnclltaewmsaskivc
    rvgqakndkgdiivttksggkgtstvsfkllkpek