PDB entry 1hjr

View 1hjr on RCSB PDB site
Description: atomic structure of the ruvc resolvase: a holliday junction-specific endonuclease from e. coli
Class: site-specific recombinase
Keywords: site-specific recombinase
Deposited on 1994-12-02, released 1995-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.157
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: holliday junction resolvase (ruvc)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hjra_
  • Chain 'B':
    Compound: holliday junction resolvase (ruvc)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hjrb_
  • Chain 'C':
    Compound: holliday junction resolvase (ruvc)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hjrc_
  • Chain 'D':
    Compound: holliday junction resolvase (ruvc)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hjrd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hjrA (A:)
    aiilgidpgsrvtgygvirqvgrqlsylgsgcirtkvddlpsrlkliyagvteiitqfqp
    dyfaieqvfmaknadsalklgqargvaivaavnqelpvfeyaarqvkqtvvgigsaeksq
    vqhmvrtllklpanpqadaadalaiaithchvsqnamq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hjrB (B:)
    aiilgidpgsrvtgygvirqvgrqlsylgsgcirtkvddlpsrlkliyagvteiitqfqp
    dyfaieqvfmaknadsalklgqargvaivaavnqelpvfeyaarqvkqtvvgigsaeksq
    vqhmvrtllklpanpqadaadalaiaithchvsqnamq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hjrC (C:)
    aiilgidpgsrvtgygvirqvgrqlsylgsgcirtkvddlpsrlkliyagvteiitqfqp
    dyfaieqvfmaknadsalklgqargvaivaavnqelpvfeyaarqvkqtvvgigsaeksq
    vqhmvrtllklpanpqadaadalaiaithchvsqnamq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hjrD (D:)
    aiilgidpgsrvtgygvirqvgrqlsylgsgcirtkvddlpsrlkliyagvteiitqfqp
    dyfaieqvfmaknadsalklgqargvaivaavnqelpvfeyaarqvkqtvvgigsaeksq
    vqhmvrtllklpanpqadaadalaiaithchvsqnamq