PDB entry 1hjd

View 1hjd on RCSB PDB site
Description: melanoma inhibitory activity (mia) protein
Class: growth factor
Keywords: growth factor, signal
Deposited on 2001-01-11, released 2002-01-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: human melanoma inhibitory activity protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q16674 (0-100)
  Domains in SCOPe 2.04: d1hjda_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hjdA (A:)
  adrklcadqecshpismavalqdymapdcrfltihrgqvvyvfsklkgrgrlfwggsvqg
  dyygdlaarlgyfpssivredqtlkpgkvdvktdkwdfycq