PDB entry 1hj9

View 1hj9 on RCSB PDB site
Description: atomic resolution structures of trypsin provide insight into structural radiation damage
Class: hydrolase
Keywords: radiation damage, disulphid bond breakage, trypsin, atomic resolution, serine proteinase
Deposited on 2001-01-10, released 2002-01-04
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: 0.1171
AEROSPACI score: 1.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-trypsin
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1hj9a_
  • Heterogens: SO4, CA, ANL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hj9A (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcayglegkgdscqgdsggp
vvcsgklqgivswgsgcqaknkpgvytkvcnyvswikqtiasn