PDB entry 1hj7

View 1hj7 on RCSB PDB site
Description: nmr study of a pair of ldl receptor ca2+ binding epidermal growth factor-like domains, 20 structures
Class: cell-surface receptor
Keywords: cell-surface receptor, calcium-binding, egf-like domain, module, apo-e, apo-b, ldl, vldl
Deposited on 2001-01-09, released 2001-07-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ldl receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: LDLR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1hj7a1, d1hj7a2
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hj7A (A:)
    gtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrcedidecqdpdtcsqlcvnleg
    gykcqceegfqldphtkack