PDB entry 1hj7

View 1hj7 on RCSB PDB site
Description: nmr study of a pair of ldl receptor ca2+ binding epidermal growth factor-like domains, 20 structures
Deposited on 2001-01-09, released 2001-07-11
The last revision prior to the SCOP 1.71 freeze date was dated 2001-08-16, with a file datestamp of 2001-08-16.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hj7A (A:)
gtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrcedidecqdpdtcsqlcvnleg
gykcqceegfqldphtkack