PDB entry 1hj6

View 1hj6 on RCSB PDB site
Description: isocitrate dehydrogenase s113e mutant complexed with isopropylmalate, nadp+ and magnesium (flash-cooled)
Class: oxidoreductase
Keywords: oxidoreductase, oxidoreductase (nad(a)-choh(d)), nadp, phosphorylation, glyoxylate bypass
Deposited on 2001-01-08, released 2001-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: ICD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hj6a_
  • Heterogens: GOL, IPM, NAP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hj6A (A:)
    meskvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykge
    rkiswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirelnvalrq
    eldlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflr
    eemgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftega
    fkdwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydvia
    cmnlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsa
    emmlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hj6A (A:)
    skvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykgerk
    iswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirelnvalrqel
    dlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflree
    mgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegafk
    dwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviacm
    nlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsaem
    mlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm