PDB entry 1hj5

View 1hj5 on RCSB PDB site
Description: cytochrome cd1 nitrite reductase, reoxidised enzyme
Class: oxidoreductase
Keywords: enzyme, nitrite reductase, oxidoreductase
Deposited on 2001-01-08, released 2001-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.195
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrite reductase
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hj5a1, d1hj5a2
  • Chain 'B':
    Compound: nitrite reductase
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hj5b1, d1hj5b2
  • Heterogens: HEC, DHE, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hj5A (A:)
    qeqvappkdpaaaledhktrtdnryepsldnlaqqdvaapgapegvsalsdaqyneanki
    yfercagchgvlrkgatgkaltpdltrdlgfdylqsfitygspagmpnwgtsgelsaeqv
    dlmanyllldpaappefgmkemreswkvhvapedrptqqendwdlenlfsvtlrdagqia
    lidgatyeiksvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigs
    earsietskmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprv
    aailashyrpefivnvketgkillvdytdldnlktteisaerflhdggldgshryfitaa
    narnklvvidtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtd
    peghpdnawkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtg
    dgsdpefktlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktle
    lkhvikderlvtptgkfnvyntmtdty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hj5A (A:)
    dpaaaledhktrtdnryepsldnlaqqdvaapgapegvsalsdaqyneankiyfercagc
    hgvlrkgatgkaltpdltrdlgfdylqsfitygspagmpnwgtsgelsaeqvdlmanyll
    ldpaappefgmkemreswkvhvapedrptqqendwdlenlfsvtlrdagqialidgatye
    iksvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsiets
    kmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashy
    rpefivnvketgkillvdytdldnlktteisaerflhdggldgshryfitaanarnklvv
    idtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdna
    wkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefk
    tlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikde
    rlvtptgkfnvyntmtdty
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hj5B (B:)
    qeqvappkdpaaaledhktrtdnryepsldnlaqqdvaapgapegvsalsdaqyneanki
    yfercagchgvlrkgatgkaltpdltrdlgfdylqsfitygspagmpnwgtsgelsaeqv
    dlmanyllldpaappefgmkemreswkvhvapedrptqqendwdlenlfsvtlrdagqia
    lidgatyeiksvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigs
    earsietskmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprv
    aailashyrpefivnvketgkillvdytdldnlktteisaerflhdggldgshryfitaa
    narnklvvidtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtd
    peghpdnawkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtg
    dgsdpefktlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktle
    lkhvikderlvtptgkfnvyntmtdty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hj5B (B:)
    dpaaaledhktrtdnryepsldnlaqqdvaapgapegvsalsdaqyneankiyfercagc
    hgvlrkgatgkaltpdltrdlgfdylqsfitygspagmpnwgtsgelsaeqvdlmanyll
    ldpaappefgmkemreswkvhvapedrptqqendwdlenlfsvtlrdagqialidgatye
    iksvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsiets
    kmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashy
    rpefivnvketgkillvdytdldnlktteisaerflhdggldgshryfitaanarnklvv
    idtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdna
    wkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefk
    tlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikde
    rlvtptgkfnvyntmtdty