PDB entry 1hj3

View 1hj3 on RCSB PDB site
Description: cytochrome cd1 nitrite reductase, dioxygen complex
Deposited on 2001-01-08, released 2001-01-16
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-16, with a file datestamp of 2001-01-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.196
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hj3A (A:)
    hktrtdnryepsldnlaqqdvaapgapegvsalsdaqyneankiyfercagchgvlrkga
    tgkaltpdltrdlgfdylqsfitygspagmpnwgtsgelsaeqvdlmanyllldpaappe
    fgmkemreswkvhvapedrptqqendwdlenlfsvtlrdagqialidgatyeiksvldtg
    yavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsietskmegwedk
    yaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashyrpefivnv
    ketgkillvdytdldnlktteisaerflhdggldgshryfitaanarnklvvidtkegkl
    vaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdnawkildsfp
    algggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefktlpiaewa
    gitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikderlvtptgk
    fnvyntmtdty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hj3A (A:)
    hktrtdnryepsldnlaqqdvaapgapegvsalsdaqyneankiyfercagchgvlrkga
    tgkaltpdltrdlgfdylqsfitygspagmplsaeqvdlmanyllldpaappefgmkemr
    eswkvhvapedrptqqendwdlenlfsvtlrdagqialidgatyeiksvldtgyavhisr
    lsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsietskmegwedkyaiagay
    wppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashyrpefivnvketgkil
    lvdytdldnlktteisaerflhdggldgshryfitaanarnklvvidtkegklvaiedtg
    gqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdnawkildsfpalgggsl
    fikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefktlpiaewagitegqp
    rvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikderlvtptgkfnvyntm
    tdty
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hj3B (B:)
    epsldnlaqqdvaapgapegvsalsdaqyneankiyfercagchgvlrkgatgkaltpdl
    trdlgfdylqsfitygspagmpnwgtsgelsaeqvdlmanyllldpaappefgmkemres
    wkvhvapedrptqqendwdlenlfsvtlrdagqialidgatyeiksvldtgyavhisrls
    asgrylfvigrdgkvnmidlwmkepttvaeikigsearsietskmegwedkyaiagaywp
    pqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashyrpefivnvketgkillv
    dytdldnlktteisaerflhdggldgshryfitaanarnklvvidtkegklvaiedtggq
    tphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdnawkildsfpalgggslfi
    kthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefktlpiaewagitegqprv
    vqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikderlvtptgkfnvyntmtd
    ty