PDB entry 1hj1

View 1hj1 on RCSB PDB site
Description: rat oestrogen receptor beta ligand-binding domain in complex with pure antioestrogen ici164,384
Class: nuclear receptor
Keywords: nuclear receptor, transcription factor, oestrogen, antagonist
Deposited on 2001-01-08, released 2002-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21966
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oestrogen receptor beta
    Species: RATTUS NORVEGICUS [TaxId:10116]
    Gene: OESTROGEN RECEPTOR BETA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hj1a_
  • Heterogens: AOE, PMB, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hj1A (A:)
    vkelllstlspeqlvltlleaeppnvlvsrpsmpfteasmmmsltkladkelvhmigwak
    kipgfvelslldqvrllescwmevlmvglmwrsidhpgklifapdlvldrdegkcvegil
    eifdmllattsrfrelklqhkeylcvkamillnssmyplasanqeaessrklthllnavt
    dalvwviaksgissqqqsvrlanllmllshvrhisnkgmehllsmkcknvvpvydlllem
    lnahltrgykssisg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hj1A (A:)
    lspeqlvltlleaeppnvlvsrpsmpfteasmmmsltkladkelvhmigwakkipgfvel
    slldqvrllescwmevlmvglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
    ttsrfrelklqhkeylcvkamillnssrklthllnavtdalvwviaksgissqqqsvrla
    nllmllshvrhisnkgmehllsmk