PDB entry 1hiw

View 1hiw on RCSB PDB site
Description: trimeric hiv-1 matrix protein
Class: matrix protein
Keywords: hiv-1, p17, hiv-1 ma, matrix protein
Deposited on 1996-02-28, released 1996-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.259
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 matrix protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hiwa_
  • Chain 'B':
    Compound: hiv-1 matrix protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hiwb_
  • Chain 'C':
    Compound: hiv-1 matrix protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hiwc_
  • Chain 'Q':
    Compound: hiv-1 matrix protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hiwq_
  • Chain 'R':
    Compound: hiv-1 matrix protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hiwr_
  • Chain 'S':
    Compound: hiv-1 matrix protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hiws_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hiwA (A:)
    hmgarasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrq
    ilgqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaa
    adtgnnsqvsqny
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hiwA (A:)
    vlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgqlqp
    slqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hiwB (B:)
    hmgarasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrq
    ilgqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaa
    adtgnnsqvsqny
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hiwB (B:)
    vlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgqlqp
    slqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hiwC (C:)
    hmgarasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrq
    ilgqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaa
    adtgnnsqvsqny
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hiwC (C:)
    vlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgqlqp
    slqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaa
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1hiwQ (Q:)
    hmgarasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrq
    ilgqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaa
    adtgnnsqvsqny
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hiwQ (Q:)
    vlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgqlqp
    slqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnks
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1hiwR (R:)
    hmgarasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrq
    ilgqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaa
    adtgnnsqvsqny
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hiwR (R:)
    vlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgqlqp
    slqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqa
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1hiwS (S:)
    hmgarasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrq
    ilgqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaa
    adtgnnsqvsqny
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hiwS (S:)
    vlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgqlqp
    slqtgseelrslyntiavlycvhqridvkdtkealdkieeeqn