PDB entry 1hiv

View 1hiv on RCSB PDB site
Description: crystal structure of a complex of hiv-1 protease with a dihydroethylene-containing inhibitor: comparisons with molecular modeling
Class: hydrolase/hydrolase inhibitor
Keywords: acid proteinase, hydrolase-hydrolase inhibitor complex
Deposited on 1992-02-12, released 1993-10-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04585 (0-98)
  Domains in SCOPe 2.03: d1hiva_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04585 (0-98)
  Domains in SCOPe 2.03: d1hivb_
• Heterogens: 1ZK, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hivA (A:)
  pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hivB (B:)
  pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf