PDB entry 1hiv
View 1hiv on RCSB PDB site
Description: crystal structure of a complex of hiv-1 protease with a dihydroethylene-containing inhibitor: comparisons with molecular modeling
Class: hydrolase(acid proteinase)
Keywords: hydrolase(acid proteinase)
Deposited on
1992-02-12, released
1993-10-31
The last revision prior to the SCOP 1.75 freeze date was dated
1993-10-31, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.5
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: Human immunodeficiency virus type 1
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1hiva_ - Chain 'B':
Compound: hiv-1 protease
Species: Human immunodeficiency virus type 1
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1hivb_ - Chain 'I':
Compound: u75875
- Heterogens: O, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1hivA (A:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1hivB (B:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'I':
No sequence available.