PDB entry 1hiv

View 1hiv on RCSB PDB site
Description: crystal structure of a complex of hiv-1 protease with a dihydroethylene-containing inhibitor: comparisons with molecular modeling
Class: hydrolase(acid proteinase)
Keywords: hydrolase(acid proteinase)
Deposited on 1992-02-12, released 1993-10-31
The last revision prior to the SCOP 1.75 freeze date was dated 1993-10-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus type 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04585 (0-98)
  Domains in SCOP 1.75: d1hiva_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus type 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04585 (0-98)
  Domains in SCOP 1.75: d1hivb_
• Chain 'I':
  Compound: u75875
  
• Heterogens: O, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hivA (A:)
  pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hivB (B:)
  pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'I':
  No sequence available.