PDB entry 1hiu

View 1hiu on RCSB PDB site
Description: receptor binding redefined by a structural switch in a mutant human insulin
Deposited on 1992-02-28, released 1994-01-31
The last revision was dated 1994-01-31, with a file datestamp of 2007-04-25.
Experiment type: NMR11
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    no info in PDB for this chain
  • Chain 'B':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1hiuA (A:)
giveqcctsicslyqlenycn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1hiuB (B:)
fvnqhlcgshlvealylvcgergffytpkt