PDB entry 1hip

View 1hip on RCSB PDB site
Description: two-angstrom crystal structure of oxidized chromatium high potential iron protein
Deposited on 1975-04-01, released 1976-11-22
The last revision prior to the SCOP 1.55 freeze date was dated 1993-04-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.24
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1hip__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hip_ (-)
  sapanavaadnataialkynqdatkservaaarpglppeeqhcadcqfmqadaagatdew
  kgcqlfpgklinvngwcaswtlkag