PDB entry 1hio

View 1hio on RCSB PDB site
Description: histone octamer (chicken), chromosomal protein, alpha carbons only
Deposited on 1991-09-19, released 1998-11-25
The last revision prior to the SCOP 1.71 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.255
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1hioa_
  • Chain 'B':
    Domains in SCOP 1.71: d1hiob_
  • Chain 'C':
    Domains in SCOP 1.71: d1hioc_
  • Chain 'D':
    Domains in SCOP 1.71: d1hiod_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hioA (A:)
    ksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
    ktriiprhlqlairndeelnkllgkvtiaqggvlp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hioB (B:)
    sysiyvykvlkqvhpdtgisskamgsmnsfvndiferiaglasrlahynkrstitsreiq
    tavrlllpgelakhavsegtkavtkhtssk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hioC (C:)
    pgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvg
    lfedtnlcaihakrvtimpkdielarrirgera
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hioD (D:)
    qgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtamdv
    vyalkrqgrtlygfgg