PDB entry 1hin

View 1hin on RCSB PDB site
Description: structural evidence for induced fit as a mechanism for antibody-antigen recognition
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1992-07-08, released 1994-01-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.22
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2a-kappa 17/9 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA38230 (0-219)
      • insertion (218)
    Domains in SCOPe 2.05: d1hinh1, d1hinh2
  • Chain 'L':
    Compound: igg2a-kappa 17/9 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR A31790 (0-216)
    Domains in SCOPe 2.05: d1hinl1, d1hinl2
  • Chain 'P':
    Compound: influenza hemagglutinin ha1 (strain x47) (residues 100-107)
    Database cross-references and differences (RAF-indexed):
    • PDB 1HIN (0-7)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hinH (H:)
    evqlvesggdlvkpggslklscaasgfsfssygmswvrqtpdkrlewvatisngggytyy
    pdsvkgrftisrdnakntlylqmsslksedsamyycarrerydengfaywgqgtlvtvsa
    akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hinL (L:)
    divmtqspssltvtagekvtmsctssqslfnsgkqknyltwyqqkpgqppkvliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndysnpltfgggtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'P':
    No sequence available.