PDB entry 1him

View 1him on RCSB PDB site
Description: structural evidence for induced fit as a mechanism for antibody-antigen recognition
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1992-07-08, released 1994-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 1994-01-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.2
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2a-kappa 17/9 fab (heavy chain)
    Database cross-references and differences (RAF-indexed):
    • PIR A31790 (0-216)
    Domains in SCOP 1.75: d1himh1, d1himh2
  • Chain 'J':
    Compound: igg2a-kappa 17/9 fab (heavy chain)
    Database cross-references and differences (RAF-indexed):
    • PIR A31790 (0-216)
    Domains in SCOP 1.75: d1himj1, d1himj2
  • Chain 'L':
    Compound: igg2a-kappa 17/9 fab (light chain)
    Database cross-references and differences (RAF-indexed):
    • GB AAA38230 (0-219)
      • insertion (218)
    Domains in SCOP 1.75: d1himl1, d1himl2
  • Chain 'M':
    Compound: igg2a-kappa 17/9 fab (light chain)
    Database cross-references and differences (RAF-indexed):
    • GB AAA38230 (0-219)
      • insertion (218)
    Domains in SCOP 1.75: d1himm1, d1himm2
  • Chain 'P':
    Compound: influenza hemagglutinin ha1 (strain x47) (residues 100-108)
  • Chain 'R':
    Compound: influenza hemagglutinin ha1 (strain x47) (residues 100-108)
  • Heterogens: NH2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1himH (H:)
    divmtqspssltvtagekvtmsctssqslfnsgkqknyltwyqqkpgqppkvliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndysnpltfgggtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1himJ (J:)
    divmtqspssltvtagekvtmsctssqslfnsgkqknyltwyqqkpgqppkvliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndysnpltfgggtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1himL (L:)
    evqlvesggdlvkpggslklscaasgfsfssygmswvrqtpdkrlewvatisngggytyy
    pdsvkgrftisrdnakntlylqmsslksedsamyycarrerydengfaywgqgtlvtvsa
    akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1himL (L:)
    evqlvesggdlvkpggslklscaasgfsfssygmswvrqtpdkrlewvatisngggytyy
    pdsvkgrftisrdnakntlylqmsslksedsamyycarrerydengfaywgqgtlvtvsa
    akttapsvyplapvgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytls
    ssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1himM (M:)
    evqlvesggdlvkpggslklscaasgfsfssygmswvrqtpdkrlewvatisngggytyy
    pdsvkgrftisrdnakntlylqmsslksedsamyycarrerydengfaywgqgtlvtvsa
    akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1himM (M:)
    evqlvesggdlvkpggslklscaasgfsfssygmswvrqtpdkrlewvatisngggytyy
    pdsvkgrftisrdnakntlylqmsslksedsamyycarrerydengfaywgqgtlvtvsa
    akttapsvyplapvgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytls
    ssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'P':
    No sequence available.

  • Chain 'R':
    No sequence available.