PDB entry 1hil

View 1hil on RCSB PDB site
Description: structural evidence for induced fit as a mechanism for antigen-antibody recognition
Deposited on 1992-07-08, released 1994-01-31
The last revision prior to the SCOP 1.69 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hilA (A:)
    divmtqspssltvtagekvtmsctssqslfnsgkqknyltwyqqkpgqppkvliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndysnpltfgggtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hilB (B:)
    evqlvesggdlvkpggslklscaasgfsfssygmswvrqtpdkrlewvatisngggytyy
    pdsvkgrftisrdnakntlylqmsslksedsamyycarrerydengfaywgqgtlvtvsa
    akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hilB (B:)
    evqlvesggdlvkpggslklscaasgfsfssygmswvrqtpdkrlewvatisngggytyy
    pdsvkgrftisrdnakntlylqmsslksedsamyycarrerydengfaywgqgtlvtvsa
    akttapsvyplapvssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
    svtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hilC (C:)
    divmtqspssltvtagekvtmsctssqslfnsgkqknyltwyqqkpgqppkvliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndysnpltfgggtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hilD (D:)
    evqlvesggdlvkpggslklscaasgfsfssygmswvrqtpdkrlewvatisngggytyy
    pdsvkgrftisrdnakntlylqmsslksedsamyycarrerydengfaywgqgtlvtvsa
    akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hilD (D:)
    evqlvesggdlvkpggslklscaasgfsfssygmswvrqtpdkrlewvatisngggytyy
    pdsvkgrftisrdnakntlylqmsslksedsamyycarrerydengfaywgqgtlvtvsa
    akttapsvyplapvssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
    svtvtsstwpsqsitcnvahpasstkvdkkiepr