PDB entry 1hi6

View 1hi6 on RCSB PDB site
Description: anti-p24 (hiv-1) fab fragment cb41 complexed with a peptide
Class: immune system/peptide
Keywords: IMMUNE SYSTEM/PEPTIDE, COMPLEX (ANTIBODY-PEPTIDE), POLYSPECIFICITY, CROSSREACTIVITY, FAB-FRAGMENT, HIV-1, IMMUNE SYSTEM-PEPTIDE complex
Deposited on 2001-01-02, released 2001-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg2a kappa antibody cb41 (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1HI6 (0-213)
    Domains in SCOPe 2.07: d1hi6a1, d1hi6a2
  • Chain 'B':
    Compound: igg2a kappa antibody cb41 (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1HI6 (0-212)
    Domains in SCOPe 2.07: d1hi6b1, d1hi6b2
  • Chain 'C':
    Compound: peptide 5
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 1HI6 (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hi6A (A:)
    dikmtqspssmytslgervtitckasqdinsfltwflqkpgkspktliyranrlmigvps
    rfsgsgsgqtysltissleyedmgiyyclqyddfpltfgagtkldlkradaaptvsifpp
    sseqltsggasvvcflnnfypkeinvkwkidgserqngvldswteqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hi6B (B:)
    qdqlqqsgaelvrpgasvklsckalgyiftdyeihwvkqtpvhglewiggihpgssgtay
    nqkfkgkatltadkssttafmelssltsedsavyyctrkdywgqgtlvtvsaakttapsv
    yplvpvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsglytlsssv
    tvtsntwpsqtitcnvahpasstkvdkkieprv
    

  • Chain 'C':
    No sequence available.