PDB entry 1hi5

View 1hi5 on RCSB PDB site
Description: eosinophil-derived neurotoxin (edn) - adenosine-5'-diphosphate complex
Deposited on 2001-01-02, released 2001-05-31
The last revision prior to the SCOP 1.61 freeze date was dated 2001-05-31, with a file datestamp of 2001-05-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1hi5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hi5A (A:)
mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn
mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd
ppqypvvpvhldrii