PDB entry 1hi4

View 1hi4 on RCSB PDB site
Description: eosinophil-derived neurotoxin (edn) -adenosine-3'-5'-diphosphate complex
Class: hydrolase
Keywords: hydrolase, RNAse-2, RNAse us, ribonuclease
Deposited on 2001-01-02, released 2001-05-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.198
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: eosinophil-derived neurotoxin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10153 (0-134)
    • cloning artifact (0)
  Domains in SCOPe 2.05: d1hi4a_
• Heterogens: A3P, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hi4A (A:)
  mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn
  mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd
  ppqypvvpvhldrii