PDB entry 1hi3

View 1hi3 on RCSB PDB site
Description: eosinophil-derived neurotoxin (edn) -adenosine-2'-5'-diphosphate complex
Class: hydrolase
Keywords: hydrolase, RNAse-2, RNAse us, ribonuclease
Deposited on 2001-01-02, released 2001-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eosinophil-derived neurotoxin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10153 (0-134)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1hi3a1, d1hi3a2
  • Heterogens: A2P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hi3A (A:)
    mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn
    mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd
    ppqypvvpvhldrii