PDB entry 1hi2

View 1hi2 on RCSB PDB site
Description: eosinophil-derived neurotoxin (edn) - sulphate complex
Class: hydrolase
Keywords: hydrolase, RNAse-2, RNAse us, ribonuclease
Deposited on 2001-01-02, released 2001-05-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.177
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: eosinophil-derived neurotoxin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10153 (0-134)
    • cloning artifact (0)
  Domains in SCOPe 2.06: d1hi2a1, d1hi2a2
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hi2A (A:)
  mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn
  mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd
  ppqypvvpvhldrii