PDB entry 1hi1

View 1hi1 on RCSB PDB site
Description: rna dependent rna polymerase from dsrna bacteriophage phi6 plus bound ntp
Deposited on 2001-01-01, released 2001-03-27
The last revision prior to the SCOP 1.59 freeze date was dated 2001-03-27, with a file datestamp of 2001-03-27.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1hi1a_
  • Chain 'B':
    Domains in SCOP 1.59: d1hi1b_
  • Chain 'C':
    Domains in SCOP 1.59: d1hi1c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hi1A (A:)
    prrapafplsdikaqmlfannikaqqaskrsfkegaietyegllsvdprflsfknelsry
    ltdhfpanvdeygrvygngvrtnffgmrhmngfpmipatwplasnlkkradadladgpvs
    erdnllfraavrlmfsdlepvplkirkgsstcipyfsndmgtkieiaeralekaeeagnl
    mlqgkfddayqlhqmggayyvvyraqstdaitldpktgkfvskdrmvadfeyavtggeqg
    slfaaskdasrlkeqygidvpdgffcerrrtamggpfalnapimavaqpvrnkiyskyay
    tfhhttrlnkeekvkewslcvatdvsdhdtfwpgwlrdlicdellnmgyapwwvklfets
    lklpvyvgapapeqghtllgdpsnpdlevglssgqgatdlmgtllmsitylvmqldhtap
    hlnsrikdmpsacrfldsywqgheeirqisksddamlgwtkgralvgghrlfemlkegkv
    npspymkisyehggaflgdillydsrrepgsaifvgninsmlnnqfspeygvqsgvrdrs
    krkrpfpglawasmkdtygacpiysdvleaiercwwnafgesyrayredmlkrdtlelsr
    yvasmarqaglaeltpidlevladpnklqykwteadvsanihevlmhgvsvekterflrs
    vmpr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hi1B (B:)
    prrapafplsdikaqmlfannikaqqaskrsfkegaietyegllsvdprflsfknelsry
    ltdhfpanvdeygrvygngvrtnffgmrhmngfpmipatwplasnlkkradadladgpvs
    erdnllfraavrlmfsdlepvplkirkgsstcipyfsndmgtkieiaeralekaeeagnl
    mlqgkfddayqlhqmggayyvvyraqstdaitldpktgkfvskdrmvadfeyavtggeqg
    slfaaskdasrlkeqygidvpdgffcerrrtamggpfalnapimavaqpvrnkiyskyay
    tfhhttrlnkeekvkewslcvatdvsdhdtfwpgwlrdlicdellnmgyapwwvklfets
    lklpvyvgapapeqghtllgdpsnpdlevglssgqgatdlmgtllmsitylvmqldhtap
    hlnsrikdmpsacrfldsywqgheeirqisksddamlgwtkgralvgghrlfemlkegkv
    npspymkisyehggaflgdillydsrrepgsaifvgninsmlnnqfspeygvqsgvrdrs
    krkrpfpglawasmkdtygacpiysdvleaiercwwnafgesyrayredmlkrdtlelsr
    yvasmarqaglaeltpidlevladpnklqykwteadvsanihevlmhgvsvekterflrs
    vmpr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hi1C (C:)
    prrapafplsdikaqmlfannikaqqaskrsfkegaietyegllsvdprflsfknelsry
    ltdhfpanvdeygrvygngvrtnffgmrhmngfpmipatwplasnlkkradadladgpvs
    erdnllfraavrlmfsdlepvplkirkgsstcipyfsndmgtkieiaeralekaeeagnl
    mlqgkfddayqlhqmggayyvvyraqstdaitldpktgkfvskdrmvadfeyavtggeqg
    slfaaskdasrlkeqygidvpdgffcerrrtamggpfalnapimavaqpvrnkiyskyay
    tfhhttrlnkeekvkewslcvatdvsdhdtfwpgwlrdlicdellnmgyapwwvklfets
    lklpvyvgapapeqghtllgdpsnpdlevglssgqgatdlmgtllmsitylvmqldhtap
    hlnsrikdmpsacrfldsywqgheeirqisksddamlgwtkgralvgghrlfemlkegkv
    npspymkisyehggaflgdillydsrrepgsaifvgninsmlnnqfspeygvqsgvrdrs
    krkrpfpglawasmkdtygacpiysdvleaiercwwnafgesyrayredmlkrdtlelsr
    yvasmarqaglaeltpidlevladpnklqykwteadvsanihevlmhgvsvekterflrs
    vmpr