PDB entry 1hht

View 1hht on RCSB PDB site
Description: rna dependent rna polymerase from dsrna bacteriophage phi6 plus template
Deposited on 2000-12-28, released 2001-03-27
The last revision prior to the SCOP 1.59 freeze date was dated 2001-03-27, with a file datestamp of 2001-03-27.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.237
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Domains in SCOP 1.59: d1hhtp_
  • Chain 'Q':
    Domains in SCOP 1.59: d1hhtq_
  • Chain 'R':
    Domains in SCOP 1.59: d1hhtr_

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hhtP (P:)
    prrapafplsdikaqmlfannikaqqaskrsfkegaietyegllsvdprflsfknelsry
    ltdhfpanvdeygrvygngvrtnffgmrhmngfpmipatwplasnlkkradadladgpvs
    erdnllfraavrlmfsdlepvplkirkgsstcipyfsndmgtkieiaeralekaeeagnl
    mlqgkfddayqlhqmggayyvvyraqstdaitldpktgkfvskdrmvadfeyavtggeqg
    slfaaskdasrlkeqygidvpdgffcerrrtamggpfalnapimavaqpvrnkiyskyay
    tfhhttrlnkeekvkewslcvatdvsdhdtfwpgwlrdlicdellnmgyapwwvklfets
    lklpvyvgapapeqghtllgdpsnpdlevglssgqgatdlmgtllmsitylvmqldhtap
    hlnsrikdmpsacrfldsywqgheeirqisksddamlgwtkgralvgghrlfemlkegkv
    npspymkisyehggaflgdillydsrrepgsaifvgninsmlnnqfspeygvqsgvrdrs
    krkrpfpglawasmkdtygacpiysdvleaiercwwnafgesyrayredmlkrdtlelsr
    yvasmarqaglaeltpidlevladpnklqykwteadvsanihevlmhgvsvekterflrs
    vmpr
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hhtQ (Q:)
    prrapafplsdikaqmlfannikaqqaskrsfkegaietyegllsvdprflsfknelsry
    ltdhfpanvdeygrvygngvrtnffgmrhmngfpmipatwplasnlkkradadladgpvs
    erdnllfraavrlmfsdlepvplkirkgsstcipyfsndmgtkieiaeralekaeeagnl
    mlqgkfddayqlhqmggayyvvyraqstdaitldpktgkfvskdrmvadfeyavtggeqg
    slfaaskdasrlkeqygidvpdgffcerrrtamggpfalnapimavaqpvrnkiyskyay
    tfhhttrlnkeekvkewslcvatdvsdhdtfwpgwlrdlicdellnmgyapwwvklfets
    lklpvyvgapapeqghtllgdpsnpdlevglssgqgatdlmgtllmsitylvmqldhtap
    hlnsrikdmpsacrfldsywqgheeirqisksddamlgwtkgralvgghrlfemlkegkv
    npspymkisyehggaflgdillydsrrepgsaifvgninsmlnnqfspeygvqsgvrdrs
    krkrpfpglawasmkdtygacpiysdvleaiercwwnafgesyrayredmlkrdtlelsr
    yvasmarqaglaeltpidlevladpnklqykwteadvsanihevlmhgvsvekterflrs
    vmpr
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hhtR (R:)
    prrapafplsdikaqmlfannikaqqaskrsfkegaietyegllsvdprflsfknelsry
    ltdhfpanvdeygrvygngvrtnffgmrhmngfpmipatwplasnlkkradadladgpvs
    erdnllfraavrlmfsdlepvplkirkgsstcipyfsndmgtkieiaeralekaeeagnl
    mlqgkfddayqlhqmggayyvvyraqstdaitldpktgkfvskdrmvadfeyavtggeqg
    slfaaskdasrlkeqygidvpdgffcerrrtamggpfalnapimavaqpvrnkiyskyay
    tfhhttrlnkeekvkewslcvatdvsdhdtfwpgwlrdlicdellnmgyapwwvklfets
    lklpvyvgapapeqghtllgdpsnpdlevglssgqgatdlmgtllmsitylvmqldhtap
    hlnsrikdmpsacrfldsywqgheeirqisksddamlgwtkgralvgghrlfemlkegkv
    npspymkisyehggaflgdillydsrrepgsaifvgninsmlnnqfspeygvqsgvrdrs
    krkrpfpglawasmkdtygacpiysdvleaiercwwnafgesyrayredmlkrdtlelsr
    yvasmarqaglaeltpidlevladpnklqykwteadvsanihevlmhgvsvekterflrs
    vmpr