PDB entry 1hhs

View 1hhs on RCSB PDB site
Description: rna dependent rna polymerase from dsrna bacteriophage phi6
Deposited on 2000-12-28, released 2001-03-27
The last revision prior to the SCOP 1.59 freeze date was dated 2001-03-27, with a file datestamp of 2001-03-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2212
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1hhsa_
  • Chain 'B':
    Domains in SCOP 1.59: d1hhsb_
  • Chain 'C':
    Domains in SCOP 1.59: d1hhsc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hhsA (A:)
    prrapafplsdikaqmlfannikaqqaskrsfkegaietyegllsvdprflsfknelsry
    ltdhfpanvdeygrvygngvrtnffgmrhmngfpmipatwplasnlkkradadladgpvs
    erdnllfraavrlmfsdlepvplkirkgsstcipyfsndmgtkieiaeralekaeeagnl
    mlqgkfddayqlhqmggayyvvyraqstdaitldpktgkfvskdrmvadfeyavtggeqg
    slfaaskdasrlkeqygidvpdgffcerrrtamggpfalnapimavaqpvrnkiyskyay
    tfhhttrlnkeekvkewslcvatdvsdhdtfwpgwlrdlicdellnmgyapwwvklfets
    lklpvyvgapapeqghtllgdpsnpdlevglssgqgatdlmgtllmsitylvmqldhtap
    hlnsrikdmpsacrfldsywqgheeirqisksddamlgwtkgralvgghrlfemlkegkv
    npspymkisyehggaflgdillydsrrepgsaifvgninsmlnnqfspeygvqsgvrdrs
    krkrpfpglawasmkdtygacpiysdvleaiercwwnafgesyrayredmlkrdtlelsr
    yvasmarqaglaeltpidlevladpnklqykwteadvsanihevlmhgvsvekterflrs
    vmpr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hhsB (B:)
    prrapafplsdikaqmlfannikaqqaskrsfkegaietyegllsvdprflsfknelsry
    ltdhfpanvdeygrvygngvrtnffgmrhmngfpmipatwplasnlkkradadladgpvs
    erdnllfraavrlmfsdlepvplkirkgsstcipyfsndmgtkieiaeralekaeeagnl
    mlqgkfddayqlhqmggayyvvyraqstdaitldpktgkfvskdrmvadfeyavtggeqg
    slfaaskdasrlkeqygidvpdgffcerrrtamggpfalnapimavaqpvrnkiyskyay
    tfhhttrlnkeekvkewslcvatdvsdhdtfwpgwlrdlicdellnmgyapwwvklfets
    lklpvyvgapapeqghtllgdpsnpdlevglssgqgatdlmgtllmsitylvmqldhtap
    hlnsrikdmpsacrfldsywqgheeirqisksddamlgwtkgralvgghrlfemlkegkv
    npspymkisyehggaflgdillydsrrepgsaifvgninsmlnnqfspeygvqsgvrdrs
    krkrpfpglawasmkdtygacpiysdvleaiercwwnafgesyrayredmlkrdtlelsr
    yvasmarqaglaeltpidlevladpnklqykwteadvsanihevlmhgvsvekterflrs
    vmpr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hhsC (C:)
    prrapafplsdikaqmlfannikaqqaskrsfkegaietyegllsvdprflsfknelsry
    ltdhfpanvdeygrvygngvrtnffgmrhmngfpmipatwplasnlkkradadladgpvs
    erdnllfraavrlmfsdlepvplkirkgsstcipyfsndmgtkieiaeralekaeeagnl
    mlqgkfddayqlhqmggayyvvyraqstdaitldpktgkfvskdrmvadfeyavtggeqg
    slfaaskdasrlkeqygidvpdgffcerrrtamggpfalnapimavaqpvrnkiyskyay
    tfhhttrlnkeekvkewslcvatdvsdhdtfwpgwlrdlicdellnmgyapwwvklfets
    lklpvyvgapapeqghtllgdpsnpdlevglssgqgatdlmgtllmsitylvmqldhtap
    hlnsrikdmpsacrfldsywqgheeirqisksddamlgwtkgralvgghrlfemlkegkv
    npspymkisyehggaflgdillydsrrepgsaifvgninsmlnnqfspeygvqsgvrdrs
    krkrpfpglawasmkdtygacpiysdvleaiercwwnafgesyrayredmlkrdtlelsr
    yvasmarqaglaeltpidlevladpnklqykwteadvsanihevlmhgvsvekterflrs
    vmpr