PDB entry 1hhn

View 1hhn on RCSB PDB site
Description: calreticulin p-domain
Class: molecular chaperone
Keywords: molecular chaperone
Deposited on 2000-12-22, released 2001-03-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calreticulin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18418 (0-100)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1hhna1, d1hhna2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hhnA (A:)
    skkikdpdaakpedwderakiddptdskpedwdkpehipdpdakkpedwdeemdgewepp
    viqnpeykgewkprqidnpdykgtwihpeidnpeyspdani