PDB entry 1hhl

View 1hhl on RCSB PDB site
Description: the three-dimensional structure of pheasant and guinea-fowl egg lysozymes
Class: hydrolase(o-glycosyl)
Keywords: hydrolase(o-glycosyl)
Deposited on 1993-05-04, released 1993-10-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.17
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: guinea fowl lysozyme
  Species: Numida meleagris [TaxId:8996]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00704 (0-128)
  Domains in SCOPe 2.04: d1hhla_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hhlA (A:)
  kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
  rwwcndgrtpgsrnlcnipcsalqssditatancakkivsdgdgmnawvawrkhckgtdv
  rvwikgcrl