PDB entry 1hh9

View 1hh9 on RCSB PDB site
Description: anti-p24 (hiv-1) fab fragment cb41 complexed with a peptide
Class: complex (antibody/peptide)
Keywords: polyspecificity, crossreactivity, fab-fragment, peptide, hiv-1
Deposited on 2000-12-21, released 2001-01-12
The last revision prior to the SCOP 1.73 freeze date was dated 2001-01-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.282
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg2a kappa antibody cb41 (light chain)
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • GB AAA38767 (0-213)
      • conflict (12)
      • conflict (21)
      • conflict (31)
      • conflict (36)
      • conflict (47)
      • conflict (54-55)
      • conflict (69-70)
      • conflict (92)
      • conflict (104)
      • conflict (142)
      • conflict (160)
      • conflict (164)
    Domains in SCOP 1.73: d1hh9a1, d1hh9a2
  • Chain 'B':
    Compound: igg2a kappa antibody cb41 (heavy chain)
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01864 (0-211)
      • conflict (1)
      • conflict (8)
      • conflict (19)
      • conflict (24)
      • conflict (27)
      • conflict (32)
      • conflict (39)
      • conflict (41-42)
      • conflict (49)
      • conflict (51)
      • conflict (55-56)
      • conflict (58)
      • conflict (61)
      • conflict (71)
      • conflict (73)
      • conflict (76)
      • conflict (79)
      • conflict (81)
      • conflict (94)
      • conflict (96)
      • conflict (98)
      • conflict (106)
      • conflict (111)
      • conflict (123)
      • conflict (128)
      • conflict (167)
      • conflict (171)
      • conflict (184)
      • conflict (190)
    Domains in SCOP 1.73: d1hh9b1, d1hh9b2
  • Chain 'C':
    Compound: pep-2
  • Heterogens: NH2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hh9A (A:)
    dikmtqspssmytslgervtitckasqdinsfltwflqkpgkspktliyranrlmigvps
    rfsgsgsgqtysltissleyedmgiyyclqyddfpltfgagtkldlkradaaptvsifpp
    sseqltsggasvvcflnnfypkeinvkwkidgserqngvldswteqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hh9B (B:)
    qdqlqqsgaelvrpgasvklsckalgyiftdyeihwvkqtpvhglewiggihpgssgtay
    nqkfkgkatltadkssttafmelssltsedsavyyctrkdywgqgtlvtvsaakttapsv
    yplvpvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsglytlsssv
    tvtsntwpsqtitcnvahpasstkvdkkieprv
    

  • Chain 'C':
    No sequence available.