PDB entry 1hh8

View 1hh8 on RCSB PDB site
Description: the active n-terminal region of p67phox: structure at 1.8 angstrom resolution and biochemical characterizations of the a128v mutant implicated in chronic granulomatous disease
Class: cell cycle
Keywords: cell cycle, phagocyte oxidase factor, sh3 domain, repeat, tpr repeat cell cycle
Deposited on 2000-12-21, released 2001-06-13
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neutrophil cytosol factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19878
      • polymorphism (180)
    Domains in SCOPe 2.02: d1hh8a_
  • Heterogens: FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hh8A (A:)
    mslveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmteaekaf
    trsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglqfklfa
    cevlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepvvipvg
    rlfrpnerqvaqlakkdylgkatvvasvvdqds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hh8A (A:)
    slveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmteaekaft
    rsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglqfklfac
    evlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepvvipvgr
    lfrpnerqvaql