PDB entry 1hh8

View 1hh8 on RCSB PDB site
Description: The active N-terminal region of p67phox: Structure at 1.8 Angstrom resolution and biochemical characterizations of the A128V mutant implicated in chronic granulomatous disease
Class: cell cycle
Keywords: cell cycle, phagocyte oxidase factor, sh3 domain, tpr repeat cell cycle
Deposited on 2000-12-21, released 2001-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neutrophil cytosol factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19878
      • variant (180)
    Domains in SCOPe 2.08: d1hh8a_
  • Heterogens: FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hh8A (A:)
    mslveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmteaekaf
    trsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglqfklfa
    cevlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepvvipvg
    rlfrpnerqvaqlakkdylgkatvvasvvdqds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hh8A (A:)
    slveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmteaekaft
    rsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglqfklfac
    evlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepvvipvgr
    lfrpnerqvaql