PDB entry 1hh7

View 1hh7 on RCSB PDB site
Description: refined crystal structure of cytochrome c2 from rhodopseudomonas palustris at 1.4 angstrom resolution
Deposited on 2000-12-21, released 2001-01-02
The last revision prior to the SCOP 1.57 freeze date was dated 2001-01-02, with a file datestamp of 2001-01-02.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.1508
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1hh7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hh7A (A:)
    edakageavfkqcmtchradknmvgpalagvvgrkagtaagftysplnhnsgeaglvwta
    dnivpyladpnaflkkfltekgkadqavgvtkmtfklaneqqrkdvvaylatlk