PDB entry 1hh7

View 1hh7 on RCSB PDB site
Description: refined crystal structure of cytochrome c2 from rhodopseudomonas palustris at 1.4 angstrom resolution
Class: electron transport
Keywords: electron transport, electron carrier, heme protein
Deposited on 2000-12-21, released 2001-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.1508
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c2
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00091 (0-113)
      • conflict (28)
      • conflict (63-64)
      • conflict (67)
      • conflict (79)
    Domains in SCOPe 2.07: d1hh7a_
  • Heterogens: HEC, SO4, NH3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hh7A (A:)
    edakageavfkqcmtchradknmvgpalagvvgrkagtaagftysplnhnsgeaglvwta
    dnivpyladpnaflkkfltekgkadqavgvtkmtfklaneqqrkdvvaylatlk