PDB entry 1hh6

View 1hh6 on RCSB PDB site
Description: anti-p24 (hiv-1) fab fragment cb41 complexed with a peptide
Deposited on 2000-12-21, released 2001-01-26
The last revision prior to the SCOP 1.69 freeze date was dated 2001-01-26, with a file datestamp of 2001-01-26.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.294
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hh6A (A:)
    dikmtqspssmytslgervtitckasqdinsfltwflqkpgkspktliyranrlmigvps
    rfsgsgsgqtysltissleyedmgiyyclqyddfpltfgagtkldlkradaaptvsifpp
    sseqltsggasvvcflnnfypkeinvkwkidgserqngvldswteqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hh6B (B:)
    qdqlqqsgaelvrpgasvklsckalgyiftdyeihwvkqtpvhglewiggihpgssgtay
    nqkfkgkatltadkssttafmelssltsedsavyyctrkdywgqgtlvtvsaakttapsv
    yplvpvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsglytlsssv
    tvtsntwpsqtitcnvahpasstkvdkkieprv