PDB entry 1hh6

View 1hh6 on RCSB PDB site
Description: anti-p24 (hiv-1) fab fragment cb41 complexed with a peptide
Class: immune system
Keywords: antibody/peptide, polyspecificity, crossreactivity, fab-fragment, peptide, hiv-1, immune system
Deposited on 2000-12-21, released 2001-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.294
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg2a kappa antibody cb41 (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1HH6 (0-10)
    Domains in SCOPe 2.07: d1hh6a1, d1hh6a2
  • Chain 'B':
    Compound: igg2a kappa antibody cb41 (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Domains in SCOPe 2.07: d1hh6b1, d1hh6b2
  • Chain 'C':
    Compound: pep-4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hh6A (A:)
    dikmtqspssmytslgervtitckasqdinsfltwflqkpgkspktliyranrlmigvps
    rfsgsgsgqtysltissleyedmgiyyclqyddfpltfgagtkldlkradaaptvsifpp
    sseqltsggasvvcflnnfypkeinvkwkidgserqngvldswteqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hh6B (B:)
    qdqlqqsgaelvrpgasvklsckalgyiftdyeihwvkqtpvhglewiggihpgssgtay
    nqkfkgkatltadkssttafmelssltsedsavyyctrkdywgqgtlvtvsaakttapsv
    yplvpvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsglytlsssv
    tvtsntwpsqtitcnvahpasstkvdkkieprv
    

  • Chain 'C':
    No sequence available.