PDB entry 1hh4

View 1hh4 on RCSB PDB site
Description: rac1-rhogdi complex involved in nadph oxidase activation
Class: signaling protein/inhibitor
Keywords: signaling protein/inhibitor, singal protein inhibitor complex, small g protein, gtpase activation, GTP-binding, prenylation, lipoprotein
Deposited on 2000-12-20, released 2001-08-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.256
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15154 (0-End)
      • cloning artifact (77)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1hh4a1, d1hh4a2
  • Chain 'B':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15154 (0-End)
      • cloning artifact (77)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1hh4b1, d1hh4b2
  • Chain 'D':
    Compound: rho GDP-dissociation inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hh4d_
  • Chain 'E':
    Compound: rho GDP-dissociation inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hh4e_
  • Heterogens: GDP, MG, GER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hh4A (A:)
    pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp
    pvkkrkrkclll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hh4A (A:)
    pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp
    pvkkrkrkc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hh4B (B:)
    pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp
    pvkkrkrkclll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hh4B (B:)
    pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp
    pvkkrkrkc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hh4D (D:)
    maeqeptaeqlaqiaaeneedehsvnykppaqksiqeiqeldkddeslrkykeallgrva
    vsadpnvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnr
    eivsgmkyiqhtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksr
    ftdddktdhlswewnltikkdwkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hh4D (D:)
    eqlaqiaaeneedehsvnykppaqksiqeiqeldkddeslrkykeallgrnvpnvvvtgl
    tlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgmkyiqhtyrk
    gvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddktdhlswewn
    ltikkd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1hh4E (E:)
    maeqeptaeqlaqiaaeneedehsvnykppaqksiqeiqeldkddeslrkykeallgrva
    vsadpnvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnr
    eivsgmkyiqhtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksr
    ftdddktdhlswewnltikkdwkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hh4E (E:)
    hsvnykppaqksiqeiqeldkddeslrkykeallgrvavsadpnvpnvvvtgltlvcssa
    pgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgmkyiqhtyrkgvkidkt
    dymvgsygpraeeyefltpveeapkgmlargsysiksrftdddktdhlswewnltikkdw