PDB entry 1hh4

View 1hh4 on RCSB PDB site
Description: rac1-rhogdi complex involved in nadph oxidase activation
Deposited on 2000-12-20, released 2001-08-28
The last revision prior to the SCOP 1.71 freeze date was dated 2001-08-28, with a file datestamp of 2001-08-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.256
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1hh4a_
  • Chain 'B':
    Domains in SCOP 1.71: d1hh4b_
  • Chain 'D':
    Domains in SCOP 1.71: d1hh4d_
  • Chain 'E':
    Domains in SCOP 1.71: d1hh4e_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hh4A (A:)
    pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp
    pvkkrkrkclll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hh4A (A:)
    pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp
    pvkkrkrkc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hh4B (B:)
    pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp
    pvkkrkrkclll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hh4B (B:)
    pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp
    pvkkrkrkc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hh4D (D:)
    maeqeptaeqlaqiaaeneedehsvnykppaqksiqeiqeldkddeslrkykeallgrva
    vsadpnvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnr
    eivsgmkyiqhtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksr
    ftdddktdhlswewnltikkdwkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hh4D (D:)
    eqlaqiaaeneedehsvnykppaqksiqeiqeldkddeslrkykeallgrnvpnvvvtgl
    tlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgmkyiqhtyrk
    gvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddktdhlswewn
    ltikkd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1hh4E (E:)
    maeqeptaeqlaqiaaeneedehsvnykppaqksiqeiqeldkddeslrkykeallgrva
    vsadpnvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnr
    eivsgmkyiqhtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksr
    ftdddktdhlswewnltikkdwkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hh4E (E:)
    hsvnykppaqksiqeiqeldkddeslrkykeallgrvavsadpnvpnvvvtgltlvcssa
    pgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgmkyiqhtyrkgvkidkt
    dymvgsygpraeeyefltpveeapkgmlargsysiksrftdddktdhlswewnltikkdw